missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30206512

Invitrogen™ Human RPS6KB2 (aa 368-472) Control Fragment Recombinant Protein

Product Code. 30206512
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30206512 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30206512 Supplier Invitrogen™ Supplier No. RP88709

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82389 (PA5-82389. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RPS6KB2 (p70S6K beta) is a serine/threonine kinase with 2 non-identical kinase catalytic domains which phosphorylates the S6 ribosomal protein and eukaryotic translation initiation factor 4B (eIF4B). Phosphorylation of S6 leads to an increase in protein synthesis and cell proliferation.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9UBS0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6199
Name Human RPS6KB2 (aa 368-472) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 70 kDa ribosomal protein S6 kinase 2; 70 kDa; KLS; p70 ribosomal S6 kinase beta; p70 S6 kinase beta; p70 S6KB; p70 S6K-beta; p70(S6K)-beta; P70-beta; P70-beta-1; P70-beta-2; p70-S6K 2; P70S6K2; p70S6Kb; ribosomal protein S6 kinase B2; ribosomal protein S6 kinase beta-2; ribosomal protein S6 kinase, 70 kD, polypeptide 2; ribosomal protein S6 kinase, 70 kDa, polypeptide 2; ribosomal protein S6 kinase, polypeptide 2; RPS6KB2; S6 kinase 2; S6 kinase-related kinase; S6K2; S6K-beta; S6K-beta2; S6K-beta-2; serine/threonine-protein kinase 14 beta; serine/threonine-protein kinase 14 B; SRK; STK14B
Common Name RPS6KB2
Gene Symbol Rps6kb2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRAPVSPLKFSPFEGFRPSPSLPEPTELPLPPLLPPPPPSTTAPLPIRPPSGTKK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.