missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RPS6KA5 Partial ORF (AAH17187.1, 372 a.a. - 470 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00009252-Q02.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16055145

  • 359.00 € / 10µg

Estimated Shipment: 23-11-2022
to see stock.
Add to basket

Description

Description

Sequence: FQGYSFVAPSILFKRNAAVIDPLQFHMGVERPGVTNVARSAMMKDSPFYQHYDLDLKDKPLGEGSFSICRKCVHKKSNQAFAVKIISKRMEANTQKEIT
Specifications

Specifications

AAH17187.1
Liquid
9252
RPS6KA5 (Human) Recombinant Protein (Q02)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC1911/MSK1/MSPK1/RLPK
RPS6KA5
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
FQGYSFVAPSILFKRNAAVIDPLQFHMGVERPGVTNVARSAMMKDSPFYQHYDLDLKDKPLGEGSFSICRKCVHKKSNQAFAVKIISKRMEANTQKEIT
RUO
RPS6KA5
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Promotions

Promotions