missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30205914

Invitrogen™ Human RORA (aa 160-226) Control Fragment Recombinant Protein

Product Code. 30205914
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30205914 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30205914 Supplier Invitrogen™ Supplier No. RP110071

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145075 (PA5-145075. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RORA is a receptor for retinoic acid belonging to the NR1 subfamily of nuclear hormone receptors with a nuclear receptor DNA binding domain. RORA binds either as a monomer or as a homodimer to the retinoic acid response element and thus regulates gene expression and also controls cell function. Though the exact function of RORA is yet unknown, it interacts with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, NM23-1, the product of a tumor metastasis suppressor candidate gene, CDK7, NCOA3 and NCOA6 coactivators. It is found to express in mesenchymal stem cells derived from bone marrow and are known to act by direct modulation of a bone matrix component. It is widely expressed in most of the tissues. Chromosomal aberrations involving RORA may be a cause of acute promyelocytic leukemia (APL).
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P35398
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6095
Name Human RORA (aa 160-226) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 9530021D13Rik; nmf267; NR1F1; Nuclear receptor ROR-alpha; nuclear receptor RZR-alpha; Nuclear receptor subfamily 1 group F member 1; RAR related orphan receptor A; RAR-related orphan receptor A; RAR-related orphan receptor alpha; retinoic acid receptor-related orphan receptor alpha; retinoid-related orphan receptor alpha; retinoid-related orphan receptor-alpha; ROR Alpha; ROR1; ROR2; ROR3; Rora; Roralpha; ROR-alpha; RORalpha1; RZRA; RZR-ALPHA; sg; staggerer; thyroid hormone nuclear receptor alpha variant 4; tmgc26; transcription factor RZR-alpha
Common Name RORA
Gene Symbol RORA
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VQKHRMQQQQRDHQQQPGEAEPLTPTYNISANGLTELHDDLSNYIDGHTPEGSKADSAVSSFYLDIQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.