missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human RMI2 Full-length ORF (NP_689521.1, 1 a.a. - 147 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
344.00 € - 521.00 €
Specifications
| Accession Number | NP_689521.1 |
|---|---|
| For Use With (Application) | Antibody Production, Protein Array, ELISA, Western Blot |
| Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID (Entrez) | 116028 |
| Molecular Weight (g/mol) | 42.3kDa |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16137283
|
Abnova™
H00116028-P01.25ug |
25 μg |
521.00 €
25µg |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
16127283
|
Abnova™
H00116028-P01.10ug |
10 μg |
344.00 €
10µg |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
RMI2 is a component of the BLM (RECQL3; MIM 604610) complex, which plays a role in homologous recombination-dependent DNA repair and is essential for genome stability (Xu et al., 2008 [PubMed 18923082]).[supplied by OMIM]
Sequence: MAAAADSFSGGPAGVRLPRSPPLKVLAEQLRRDAEGGPGAWRLSRAAAGRGPLDLAAVWMQGRVVMADRGEARLRDPSGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNIPSpecifications
| NP_689521.1 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 42.3kDa | |
| Glutathione Sepharose 4 Fast Flow | |
| MAAAADSFSGGPAGVRLPRSPPLKVLAEQLRRDAEGGPGAWRLSRAAAGRGPLDLAAVWMQGRVVMADRGEARLRDPSGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNIP | |
| RUO | |
| RMI2 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 116028 | |
| RMI2 (Human) Recombinant Protein (P01) | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| BLAP18/C16orf75 | |
| RMI2 | |
| Recombinant | |
| wheat germ expression system |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title