missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RMI2 Full-length ORF (NP_689521.1, 1 a.a. - 147 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

335.00 € - 508.00 €

Specifications

Accession Number NP_689521.1
For Use With (Application) Antibody Production, Protein Array, ELISA, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 116028
Molecular Weight (g/mol) 42.3kDa
View More Specs

Products 2
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
16137283
View Documents Promotion Details
Abnova™
H00116028-P01.25UG
25 ug
508.00 €
25µg
View alternative products
Save Up to 
»
Estimated Shipment: 25-06-2024
to see stock.
Please to purchase this item. Need a web account? Register with us today!
16127283
View Documents Promotion Details
Abnova™
H00116028-P01.10UG
10 ug
335.00 €
10µg
View alternative products
Save Up to 
»
Estimated Shipment: 25-06-2024
to see stock.
Please to purchase this item. Need a web account? Register with us today!
Description

Description

RMI2 is a component of the BLM (RECQL3; MIM 604610) complex, which plays a role in homologous recombination-dependent DNA repair and is essential for genome stability (Xu et al., 2008 [PubMed 18923082]).[supplied by OMIM]

Sequence: MAAAADSFSGGPAGVRLPRSPPLKVLAEQLRRDAEGGPGAWRLSRAAAGRGPLDLAAVWMQGRVVMADRGEARLRDPSGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNIP
Specifications

Specifications

NP_689521.1
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
42.3kDa
Glutathione Sepharose 4 Fast Flow
MAAAADSFSGGPAGVRLPRSPPLKVLAEQLRRDAEGGPGAWRLSRAAAGRGPLDLAAVWMQGRVVMADRGEARLRDPSGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNIP
RUO
RMI2
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, Protein Array, ELISA, Western Blot
116028
RMI2 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
BLAP18/C16orf75
RMI2
Recombinant
wheat germ expression system
Videos
SDS
Documents

Documents

Product Certifications