missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30200663

Invitrogen™ Human RIM3 (aa 53-85) Control Fragment Recombinant Protein

Product Code. 30200663
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200663

Brand: Invitrogen™ RP106619

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65937 (PA5-65937. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Rab3-interacting molecules (RIMs) are synaptic proteins are synaptic proteins necessary for neural transmission and plasticity. While both Rim1 and Rim 2 are thought to be effector proteins for Rab3, binding to Rab3 on synaptic vesicles in a GTP-dependent manner, less is known of Rim3. Expression of Rim3 in PC12 cells induced a significant increase in calcium-triggered exocytosis, with no appreciable change in the baseline release, suggesting that it plays a role in the regulation of exocytosis. Rim3 protein localizes primarily to neuronal dendrites and the postsynaptic densities, as opposed to Rim1 which is found in presynapse locations, indicating that Rim3 may contribute to synapse transmission and plasticity.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9UJD0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9783
Name Human RIM3 (aa 53-85) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A730060M23Rik; KIAA0237; mKIAA0237; Nim2; NIM3; Rab-3 interacting molecule 3; rab-3-interacting molecule 3; regulating synaptic membrane exocytosis 3; regulating synaptic membrane exocytosis protein 3; RIM 3; RIM3; RIM3 gamma; Rims3; RP4-739H11.2; si:ch211-239d6.1
Common Name RIM3
Gene Symbol RIMS3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MVAIVGLTQWSKSTLQLPQPEGATKKLRSNIRR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.