missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human RAD21 (aa 359-504) Control Fragment Recombinant Protein

Product Code. 30209177
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30209177 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30209177 Supplier Invitrogen™ Supplier No. RP101037

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54128 (PA5-54128. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a nuclear protein that regulates transcriptional elongation and pre-mRNA splicing. The encoded protein interacts with the hyperphosphorylated C-terminal domain of RNA polymerase II via multiple FF domains, and with the pre-mRNA splicing factor SF1 via a WW domain. Alternative splicing results in multiple transcripts variants encoding different isoforms.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O60216
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5885
Name Human RAD21 (aa 359-504) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 64-kDa carboxy-terminal product; 64-kDa C-terminal product; 65-kDa carboxy-terminal product; CDLS4; double-strand-break repair protein rad21 homolog; double-strand-break repair protein rad21-like protein; FLJ25655; FLJ40596; h NXP-1; hHR21; HR21; HRAD21; KIAA0078; KIAA0078RAD21; kleisin; MCD1; mHR21; mKIAA0078; nuclear matrix protein 1; NXP1; NXP-1; Pokeweed agglutinin-binding protein 29; protein involved in DNA double-strand break repair; PW29; Rad21; RAD21 cohesin complex component; RAD21 homolog; RAD21 homolog (S. pombe); SCC1; SCC1 homolog; sister chromatid cohesion 1
Common Name RAD21
Gene Symbol Rad21
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KLMMWKETGGVEKLFSLPAQPLWNNRLLKLFTRCLTPLVPEDLRKRRKGGEADNLDEFLKEFENPEVPREDQQQQHQQRDVIDEPIIEEPSRLQESVMEASRTNIDESAMPPPPPQGVKRKAGQIDPEPVMPPQQVEQMEIPPVEL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.