missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30199068

Invitrogen™ Human PUM2 (aa 117-180) Control Fragment Recombinant Protein

Product Code. 30199068
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30199068 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30199068 Supplier Invitrogen™ Supplier No. RP104881

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111295 (PA5-111295. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LZTS2 is a negative regulator of katanin-mediated microtubule severing and release from the centrosome. LZTS2 is required for central spindle formation and the completion of cytokinesis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8TB72
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23369
Name Human PUM2 (aa 117-180) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5730503J23Rik; FLJ36528; KIAA0235; MGC138251; MGC138253; mKIAA0235; OTTHUMP00000200539; PUM1; Pum2; PUMH2; pumilio 2; pumilio homolog 2; pumilio RNA binding family member 2; pumilio RNA-binding family member 2; pumilio-2; PUML2; Pumm2
Common Name PUM2
Gene Symbol PUM2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GTRDAETDGPEKGDQKGKASPFEEDQNRDLKQGDDDDSKINGRGLPNGMDADCKDFNRTPGSRQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.