missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PRAP1 Full-length ORF (NP_660203.2, 1 a.a. - 151 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00118471-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16137433

  • 335.00 € / 10µg
Estimated Shipment: 31-05-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: MRRLLLVTSLVVVLLWEAGAVPAPKVPIKMQVKHWPSEQDPEKAWGARVVEPPEKDDQLVVLFPVQKPKLLTTEEKPRGQGRGPILPGTKAWMETEDTLGRVLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGPEEDQDHIYHPQ
Specifications

Specifications

NP_660203.2
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
43.6kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC126792/PRO1195/RP11-122K13.6/UPA
PRAP1
Recombinant
wheat germ expression system
Antibody Production, Protein Array, ELISA, Western Blot
118471
PRAP1 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MRRLLLVTSLVVVLLWEAGAVPAPKVPIKMQVKHWPSEQDPEKAWGARVVEPPEKDDQLVVLFPVQKPKLLTTEEKPRGQGRGPILPGTKAWMETEDTLGRVLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGPEEDQDHIYHPQ
RUO
PRAP1
Wheat Germ (in vitro)
GST
Liquid
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Promotions

Promotions