missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30197696

Invitrogen™ Human POMGNT1 (aa 162-241) Control Fragment Recombinant Protein

Product Code. 30197696
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30197696 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30197696 Supplier Invitrogen™ Supplier No. RP94043

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60735 (PA5-60735. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The product of the POMGNT1 gene, protein O-mannose beta-1,2-N-acetylglucosaminyltransferase, participates in O-mannosyl glycan synthesis. POMGnT1 is an N(in)/C(out) (type II) membrane protein localized in the medial-Golgi that initiates the conversion of high mannose N-glycans to complex N-glycans. Specifically, POMGnT1 is a glycosylation enzyme that participates in the synthesis of O-mannosyl glycan, a laminin-binding ligand of alpha-dystroglycan that is rarely synthesized in mammals. Mutations in the POMGNT1 gene cause muscle-eye-brain disease (MEB), an autosomal recessive disorder characterized by congenital muscular dystrophy, ocular abnormalities and lissencephaly.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8WZA1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55624
Name Human POMGNT1 (aa 162-241) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 0610016I07Rik; 4930467B06Rik; GnT I0.2; GNTI0.2; gnT-I0.2; LGMD2O; MDDGA3; MDDGB3; MDDGC3; MEB; MGAT1.2; N-acetylglucosaminyltransferase I0.2; O-linked mannose beta1,2-N-acetylglucosaminyltransferase; O-mannosyl N-acetylglucosaminyltransferase; OMGnT1; POMGNT1; protein O-linked mannose beta 1,2-N-acetylglucosaminyltransferase; protein O-linked mannose beta1,2-N-acetylglucosaminyltransferase; protein O-linked mannose N-acetylglucosaminyltransferase 1 (beta 1,2-); protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1; protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1; LOW QUALITY PROTEIN: protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1; RP11-322N21.3; UDP-GlcNAc:alpha-D-mannoside beta-1,2-N-acetylglucosaminyltransferase I0.2; UNQ746/PRO1475
Common Name POMGNT1
Gene Symbol POMGNT1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LFLNMVAPGRVLICTVKDEGSFHLKDTAKALLRSLGSQAGPALGWRDTWAFVGRKGGPVFGEKHSKSPALSSWGDPVLLK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.