missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30197713

Invitrogen™ Human Perlecan (aa 485-577) Control Fragment Recombinant Protein

Product Code. 30197713
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30197713

Brand: Invitrogen™ RP109301

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140142 (PA5-140142. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Perlecan is a major heparan-sulfate proteoglycan (HSPG) found within all basement membranes and cell surfaces. Because of its strategic location and ability to store and protect growth factors, perlecan has been strongly implicated in the control of tumor cell growth and metastatic behavior. Perlecan possesses angiogenic and growth-promoting attributes primarily by acting as a coreceptor for basic fibroblast growth factor (FGF-2). Suppression of perlecan causes substantial inhibition of neoplastic growth and neovascularization. Thus, perlecan is a potent inducer of neoplasm growth and angiogenesis in vivo and therapeutic interventions targeting this key modulator of tumor progression may improve neoplastic treatment.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P98160
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3339
Name Human Perlecan (aa 485-577) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI852380; Basement membrane-specific heparan sulfate proteoglycan core protein; Endorepellin; endorepellin (domain V region); heparan sulfate proteoglycan 2; HSPG; Hspg2; LG3 peptide; LOC313641; Pcn; per; perlecan; perlecan (heparan sulfate proteoglycan 2); perlecan proteoglycan; PLC; PRCAN; RP11-132G19.2; SJA; SJS; SJS1
Common Name Perlecan
Gene Symbol HSPG2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RGMVFGIPDGVLELVPQRGPCPDGHFYLEHSAACLPCFCFGITSVCQSTRRFRDQIRLRFDQPDDFKGVNVTMPAQPGTPPLSSTQLQIDPSL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.