missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Peripherin (aa 12-101) Control Fragment Recombinant Protein

Product Code. 30204829
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30204829

Brand: Invitrogen™ RP102868

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Peripherin is a 57kD type III intermediate filament that is a specific marker for peripheral neurons, including enteric ganglion cells. Peripherin is expressed in the developing peripheral nervous system and is highly enriched in neuronal derivatives of the neural crest. Peripherin offers an advantage over other neural markers, such as S100 and NSE in that it does not stain chrmaffin cell types.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P41219
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5630
Name Human Peripherin (aa 12-101) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias if3; nef4; Neurofilament 4; neurofilament 4 (57 kD); neuronal intermediate filament IF3; Perf; Peripherin; peripherin 1; peripherin L homeolog; plasticin; PRPH; prph.L; PRPH1; XELAEV_18013332mg; XIF3
Common Name Peripherin
Gene Symbol PRPH
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FSSTSYRRTFGPPPSLSPGAFSYSSSSRFSSSRLLGSASPSSSVRLGSFRSPRAGAGALLRLPSERLDFSMAEALNQEFLATRSNEKQEL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.