missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human OPA1 (aa 707-803) Control Fragment Recombinant Protein

Product Code. 30196270
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30196270

Brand: Invitrogen™ RP96480

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57874 (PA5-57874. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

OPA1 is a dynamin-related GTPase that is critical for the maintenance of mitochondrial morphology and mtDNA. The most commonly associated phenotype with OPA1 mutations is heterozygous optic atrophy, a heterozygous dominant trait that causes reduced visual clarity and sometimes blindness. The disease usually begins in childhood and increases in severity throughout the life of affected individuals. Usually, this phenotype is attributed to the degeneration of optic nerve fibers. Interestingly, the same type of nerve degeneration seems to be partially causative of certain schizophrenia characteristics. OPA1 dysfunction also seems to be implicated in this case; mitochondrial networks associated with critical nerves seem to link schizophrenia and OPA1. The dysfunction is associated with issues with apoptosis and normal cellular metabolic regulation, all regulated through OPA1.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O60313
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4976
Name Human OPA1 (aa 707-803) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1200011N24Rik; AI225888; AI847218; BERHS; Dynamin-like 120 kDa protein, form S1; Dynamin-like 120 kDa protein, mitochondrial; dynamin-like guanosine triphosphatase; EMBL:AAI11072.1}; hypothetical protein; KIAA0567; Large GTP-binding protein; largeG; lilr3; MGM1; mitochondrial dynamin-like GTPase; mitochondrial OPA1; mKIAA0567; MTDPS14; NPG; NTG; OPA1; opa1 {ECO:0000312; OPA1 mitochondrial dynamin like GTPase; OPA1, mitochondrial dynamin like GTPase; optic atrophy 1; optic atrophy 1 (autosomal dominant); optic atrophy 1 homolog; optic atrophy 1-like protein; optic atrophy protein 1; Optic atrophy protein 1 homolog; RCJMB04_1m16; RN protein
Common Name OPA1
Gene Symbol OPA1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ESIKRHKWNDFAEDSLRVIQHNALEDRSISDKQQWDAAIYFMEEALQARLKDTENAIENMVGPDWKKRWLYWKNRTQEQCVHNETKNELEKMLKCNE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.