missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30196257

Invitrogen™ Human NSF (aa 462-572) Control Fragment Recombinant Protein

Product Code. 30196257
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30196257 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30196257 Supplier Invitrogen™ Supplier No. RP101054

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110667 (PA5-110667. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Required for vesicle-mediated transport. Catalyzes the fusion of transport vesicles within the Golgi cisternae. Is also required for transport from the endoplasmic reticulum to the Golgi stack. Seem to function as a fusion protein required for the delivery of cargo proteins to all compartments of the Golgi stack independent of vesicle origin.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P46459
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4905
Name Human NSF (aa 462-572) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI316878; AU020090; AU067812; Erg1; NEM-sensitive fusion protein; N-ethylmaleimide sensitive factor; N-ethylmaleimide sensitive factor, vesicle fusing ATPase; N-ethylmaleimide sensitive fusion protein; N-ethylmaleimide-sensitive factor; N-ethylmaleimide-sensitive factor-like protein; N-ethylmaleimide-sensitive fusion protein; NSF; Protein SKD2; Skd2; suppressor of K(+) transport growth defect 2; Vesicle-fusing ATPase; vesicle-fusing ATPase-like protein; vesicular-fusion protein NSF
Common Name NSF
Gene Symbol NSF
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KVEVDMEKAESLQVTRGDFLASLENDIKPAFGTNQEDYASYIMNGIIKWGDPVTRVLDDGELLVQQTKNSDRTPLVSVLLEGPPHSGKTALAAKIAEESNFPFIKICSPDK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.