missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human NMNAT1 (aa 60-134) Control Fragment Recombinant Protein

Product Code. 30204565
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30204565

Brand: Invitrogen™ RP101965

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84418 (PA5-84418. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The coenzyme NAD and its derivatives are involved in hundreds of metabolic redox reactions and are utilized in protein ADP-ribosylation, histone deacetylation, and in some Ca(2+) signaling pathways. NMNAT (EC 2.7.7.1) is a central enzyme in NAD biosynthesis, catalyzing the condensation of nicotinamide mononucleotide (NMN) or nicotinic acid mononucleotide (NaMN) with the AMP moiety of ATP to form NAD or NaAD.The coenzyme NAD and its derivatives are involved in hundreds of metabolic redox reactions and are utilized in protein ADP-ribosylation, histone deacetylation, and in some Ca(2+) signaling pathways. NMNAT (EC 2.7.7.1) is a central enzyme in NAD biosynthesis, catalyzing the condensation of nicotinamide mononucleotide (NMN) or nicotinic acid mononucleotide (NaMN) with the AMP moiety of ATP to form NAD or NaAD (Zhang et al., 2003 [PubMed 12574164]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9HAN9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 64802
Name Human NMNAT1 (aa 60-134) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2610529L11Rik; 5730441G13Rik; D4Cole1e; deamido-NAD(+) diphosphorylase; deamido-NAD(+) pyrophosphorylase; EC 2.7.7.1; EC 2.7.7.18; id:ibd5068; im:7144541; LCA9; NAD(+) diphosphorylase; NAD(+) pyrophosphorylase; naMN adenylyltransferase 1; nicotinamide mononucleotide adenylyl transferase; nicotinamide mononucleotide adenylyl transferase 1; nicotinamide mononucleotide adenylyltransferase 1; nicotinamide mononucleotide adenylyltransferase 1-like protein; nicotinamide nucleotide adenylyltransferase 1; nicotinamide/nicotinate mononucleotide adenylyltransferase 1; nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1; nicotinamide-nucleotide adenylyltransferase 1; Nicotinate-nucleotide adenylyltransferase 1; NMN adenylyltransferase 1; NMN/NaMN adenylyltransferase 1; nmnat; NMNAT1; NMNATPNAT1; PNAT1; PNAT-1; pyridine nucleotide adenylyltransferase 1; zgc:110243
Common Name NMNAT1
Gene Symbol NMNAT1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.