missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30212492

Invitrogen™ Human NFS1 (aa 264-358) Control Fragment Recombinant Protein

Product Code. 30212492
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30212492 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30212492 Supplier Invitrogen™ Supplier No. RP103109

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62485 (PA5-62485. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NFS1 (nitrogen fixation 1), also known as NIFS or IscS (cysteine desulfurase), is a member of the class V pyridoxal-phosphate-dependent aminotransferase family. It localizes to the cytoplasm or mitochondrion depending on which form is generated based on cytosolic pH. Highest expression levels of NFS1 are found in heart and skeletal muscle. Lower levels of expression are also found in liver, brain and pancreas. NFS1 is responsible for catalyzing the removal of sulfur from cysteine to form alanine, thereby supplying the inorganic sulfur for iron-sulfur (Fe-S) clusters. Fe-S clusters function as essential cofactors in a wide variety of events, including facilitation of electron transfer processes in oxidative phosphorylation, catalysis of enzymatic reactions in aconitase and dehydratases and maintenance of structural integrity in the DNA repair enzyme endonuclease III.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9Y697
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9054
Name Human NFS1 (aa 264-358) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA987187; cysteine desulfurase, mitochondrial; Cysteine desulfurase, mitochondrial-like protein; HUSSY-08; IscS; LOW QUALITY PROTEIN: cysteine desulfurase, mitochondrial; m-Nfs1; m-Nfsl; Nfs1; NFS1 cysteine desulfurase; NFS1 nitrogen fixation 1 homolog; NFS1 nitrogen fixation 1 homolog (S. cerevisiae); NFS1, cysteine desulfurase; Nifs; nifS-like (sic); nitrogen fixation 1 (S. cerevisiae, homolog); nitrogen fixation gene 1; nitrogen fixation gene 1 (S. cerevisiae); nitrogen fixation gene, yeast homolog 1; nitrogen-fixing bacteria S-like protein
Common Name NFS1
Gene Symbol NFS1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GVGAIYIRRRPRVRVEALQSGGGQERGMRSGTVPTPLVVGLGAACEVAQQEMEYDHKRISKLSERLIQNIMKSLPDVVMNGDPKHHYPGCINLSF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.