missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human NCOA4 (aa 524-613) Control Fragment Recombinant Protein

Product Code. 30209901
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30209901 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30209901 Supplier Invitrogen™ Supplier No. RP103588

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-65653 (PA5-65653, PA5-64203 (PA5-64203. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Androgen receptor (AR) coactivator ARA70, also designated NCOA4, RFG and ELE1, is a putative co-activator that specifically enhances the activity of the androgen receptor. In human thyroid carcinomas, the Ret proto-oncogene fuses to ARA70 to form Ret/PTC3 by an intrachromosomal inversion of chromosome in vivo. ARA70 is expressed as two isoforms, ARA70a and ARA70b. The shorter variant, ARA70b, results from an internal 985-bp deletion. ARA70a is widely expressed, and its expression is highest in testis and adipose tissues, whereas ARA70b is solely expressed in the testis. ARA70a can function as a ligand-enhanced co-activator of PPARg in adipocytes. ARA70 may be involved in prostate carcinogenesis and ovarian cancer and may serve as a key mediator of estrogen-androgen synergism.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q13772
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8031
Name Human NCOA4 (aa 524-613) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 70 kDa androgen receptor coactivator; 70 kDa AR-activator; Androgen receptor coactivator 70 kDa protein; Androgen receptor-associated protein of 70 kDa; ARA70; ELE1; NCOA4; NCoA-4; Nuclear receptor coactivator 4; PTC3; ret fused; RET-activating gene ELE1; Ret-activating protein ELE1; RFG
Common Name NCOA4
Gene Symbol NCOA4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWLLRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.