missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30201306

Invitrogen™ Human NAPSA (aa 238-268) Control Fragment Recombinant Protein

Product Code. 30201306
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30201306

Brand: Invitrogen™ RP100024

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60970 (PA5-60970. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Napsin 1 is an aspartic protease that is generally expressed in the lung, but also present in kidney and in metastatic carcinomas throughout the body. Napsin 1 processes surfactant protein B in healthy pulmonary and renal tissues, but is abnormally regulated when carcinogenesis occurs. Thus, many researchers have found napsin evaluation to be useful in identifying several cancers, and differentiating primary tumors from metastases. When combined with thyroid transcription factor analysis, napsin can be used as a specific biomarker for differentiation of carcinoma types. Napsin has also been associated with pulmonary alveolar proteinosis as well as in protein catabolism in renal tubules.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O96009
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9476
Name Human NAPSA (aa 238-268) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias asp 4; ASP4; Aspartyl protease 4; KAP; Kdap; KDAP-1; kidney-derived aspartic protease-like protein; Nap; NAP1; NAPA; Napsa; napsin A aspartic peptidase; napsin-1; Napsin-A; pronapsin; pronapsin A; SNAPA; TA01/TA02
Common Name NAPSA
Gene Symbol NAPSA
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SDPAHYIPPLTFVPVTVPAYWQIHMERVKVG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.