missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human MYOM3 Partial ORF (NP_689585, 854 a.a. - 955 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

341.70 € - 518.16 €

Specifications

Name MYOM3 (Human) Recombinant Protein (Q01)
Recombinant Yes
For Use With (Application) Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Molecular Weight 36.96kDa
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
View More Specs

Products 2
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
16101737
View Documents Promotion Details
Abnova™
H00127294-Q01.25UG
25 ug
518.16 €
25µg
View alternative products
Save Up to 
»
Estimated Shipment: 15-03-2022
Add to basket
 
16191727
View Documents Promotion Details
Abnova™
H00127294-Q01.10UG
10 ug
341.70 €
10µg
View alternative products
Save Up to 
»
Estimated Shipment: 15-03-2022
Add to basket
 
Description

Description

Sequence: GPYFERPLQWKVTEDCQVQLTCKVTNTKKETRFQWFFQRAEMPDGQYDPETGTGLLCIEELSKKDKGIYRAMVSDDRGEDDTILDLTGDALDAIFTELGRIG
Specifications

Specifications

MYOM3 (Human) Recombinant Protein (Q01)
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Yes
36.96kDa
SDS
Product Certifications