missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human MTHFD2L Full-length ORF (AAH32771.1, 1 a.a. - 146 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00441024-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16100734

  • 518.16 € / 25µg

Estimated Shipment: 24-01-2022
Add to basket

Description

Description

Sequence: MDPRVSGILVQLPLPDHVDERTICNGIAPEKDVDGFHIINIGRLCLDQHSLIPATASAVWEIIKRTGIQTFGKNVVVAGRSKNVGMPIAMLLHTDGEHERPGGDATVTIAHRYTPKEQLKIHTQLADIIIVAAERFHHFAQDLSNS
Specifications

Specifications

AAH32771.1
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
42.4kDa
Glutathione Sepharose 4 Fast Flow
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ13105/MGC45532/MGC72244
MTHFD2L
Yes
wheat germ expression system
Liquid
441024
MTHFD2L (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MDPRVSGILVQLPLPDHVDERTICNGIAPEKDVDGFHIINIGRLCLDQHSLIPATASAVWEIIKRTGIQTFGKNVVVAGRSKNVGMPIAMLLHTDGEHERPGGDATVTIAHRYTPKEQLKIHTQLADIIIVAAERFHHFAQDLSNS
RUO
MTHFD2L
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Promotions

Promotions