missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MST1 (STK4) (aa 355-435) Control Fragment Recombinant Protein

Product Code. 30199868
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30199868 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30199868 Supplier Invitrogen™ Supplier No. RP91405

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53295 (PA5-53295. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

STK4 (MST1) is a serine/threonine kinase which may be involved in apoptosis. It is possible that this protein induces the chromatin condensation observed in this process. STK4 is a stress-activated, pro-apoptotic kinase which, following caspase-cleavage, enters the nucleus and induces chromatin condensation followed by internucleosomal DNA fragmentation. It is a key component of the Hippo signaling pathway which plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Phosphorylation of YAP1 by LATS2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. STK3/MST2 and STK4/MST1 are required to repress proliferation of mature hepatocytes, to prevent activation of facultative adult liver stem cells (oval cells), and to inhibit tumor formation.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q13043
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6789
Name Human MST1 (STK4) (aa 355-435) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI447339; AU020804; EC 2.7.11.1; Kas-2; kinase MST1; kinase responsive to stress 2; KRS2; Mammalian STE20-like protein kinase 1; mammalian sterile 20-like 1; MST1; MST-1; MST1/C; MST1/N; serine/threonine kinase 4; serine/threonine-protein kinase 4; Serine/threonine-protein kinase 4 18 kDa subunit; Serine/threonine-protein kinase 4 37 kDa subunit; Serine/threonine-protein kinase Krs-2; STE20-like kinase MST1; sterile 20-like kinase 1; STK4; TIIAC; Yeast Sps1/Ste20-related kinase 3; Ysk3
Common Name MST1 (STK4)
Gene Symbol Stk4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IEHDDTLPSQLGTMVINAEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.