missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30205479

Invitrogen™ Human MOZ (aa 892-967) Control Fragment Recombinant Protein

Product Code. 30205479
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30205479

Brand: Invitrogen™ RP107223

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66566 (PA5-66566. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Histone acetyltransferase that acetylates lysine residues in histone H3 and histone H4 (in vitro). Component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity. May act as a transcriptional coactivator for RUNX1 and RUNX2. Acetylates p53/TP53 at 'Lys-120' and 'Lys-382' and controls its transcriptional activity via association with PML.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q92794
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7994
Name Human MOZ (aa 892-967) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1500036M03; 9930021N24Rik; histone acetyltransferase KAT6A; histone acetyltransferase MYST3; K(lysine) acetyltransferase 6 A; KAT6A; lysine acetyltransferase 6 A; monocytic leukemia zinc finger homolog; Monocytic leukemia zinc finger protein; Moz; MOZ, YBF2/SAS3, SAS2 and TIP60 protein 3; MRD32; MYST histone acetyltransferase (monocytic leukemia) 3; Myst3; MYST-3; runt-related transcription factor binding protein 2; Runt-related transcription factor-binding protein 2; RUNXBP2; ZC2HC6A; Zfp220; zinc finger protein 220; ZNF220
Common Name MOZ
Gene Symbol Kat6a
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SSAPQEQYGECGEKSEATQEQYTESEEQLVASEEQPSQDGKPDLPKRRLSEGVEPWRGQLKKSPEALKCRLTEGSE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.