missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30199833

Invitrogen™ Human MKP-1 (aa 311-359) Control Fragment Recombinant Protein

Product Code. 30199833
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199833

Brand: Invitrogen™ RP105479

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84818 (PA5-84818. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The expression of DUSP1 gene is induced in human skin fibroblasts by oxidative/heat stress and growth factors. It specifies a protein with structural features similar to members of the non-receptor-type protein-tyrosine phosphatase family, and which has significant amino-acid sequence similarity to a Tyr/Ser-protein phosphatase encoded by the late gene H1 of vaccinia virus. The bacterially expressed and purified DUSP1 protein has intrinsic phosphatase activity, and specifically inactivates mitogen-activated protein (MAP) kinase in vitro by the concomitant dephosphorylation of both its phosphothreonine and phosphotyrosine residues. Furthermore, it suppresses the activation of MAP kinase by oncogenic ras in extracts of Xenopus oocytes. Thus, DUSP1 may play an important role in the human cellular response to environmental stress as well as in the negative regulation of cellular proliferation.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P28562
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1843
Name Human MKP-1 (aa 311-359) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 3 ch134; 3 CH134/CL100 PTPase; CL 100; CL100; dual specificity phosphatase 1; dual specificity protein phosphatase 1; Dual specificity protein phosphatase hVH1; DUS1; DUSP1; EC 3.1.3.16; EC 3.1.3.48; erp; HVH1; MAP kinase phosphatase 1; MAP kinase phosphatase-1; mitogen-activated protein (MAP) kinase phosphatase-1; mitogen-activated protein kinase phosphatase 1; mitogen-activated protein kinase phosphatase-1; MKP1; mkp-1; oxidative stress-inducible protein tyrosine phosphatase; protein tyrosine phosphatase non-receptor type 16; protein tyrosine phosphatase, non-receptor type 16; protein-tyrosine phosphatase 3 CH134; Protein-tyrosine phosphatase CL100; protein-tyrosine phosphatase ERP; Protein-tyrosine phosphatase non-receptor type 16; PTPN10; Ptpn16; serine/threonine specific protein phosphatase; U19515; VH1
Common Name MKP-1
Gene Symbol Dusp1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.