missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30193918

Invitrogen™ Human mDIC (aa 75-145) Control Fragment Recombinant Protein

Product Code. 30193918
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30193918

Brand: Invitrogen™ RP93516

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The mitochondrial dicarboxylate carrier protein (mDIC) belongs to superfamily of mitochondrial transporters. It has been demonstrated that the expression of mDIC leads to hyperpolarization of the mitochondria, as well as succinate uptake by the mitochondria. It is highly expressed in adipose tissue, where its expression is downregulated by insulin and upregulated by free fatty acids. mDIC is also thought to play a role in glyceroneogenesis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9UBX3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1468
Name Human mDIC (aa 75-145) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias DIC; dicarboxylate ion carrier; dicarboxylate transporter), member 10; mitochondrial dicarboxylate carrier; Slc25a10; solute carrier family 25 (mitochondrial carrier, dicarboxylate transporter), member 10; solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 10; solute carrier family 25 (mitochondrial carrier; dicarboxylate transporter), member 10; solute carrier family 25 member 10
Common Name mDIC
Gene Symbol SLC25A10
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SLTRFAIYETVRDRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPADLVNVRMQNDVKLPQGQRRNYAHAL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.