missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MAST2 (aa 1539-1606) Control Fragment Recombinant Protein

Product Code. 30180522
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30180522 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30180522 Supplier Invitrogen™ Supplier No. RP98307

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (46%), Rat (46%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58900 (PA5-58900. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Syntrophin is an adapter protein that functions to bind certain signaling molecules to the dystrophin-associated protein complex. This complex connects the extracellular matrix to the intracellular cytoskeleton for construction and maintenance of the postsynaptic structures in the neuromuscular junction and the central nervous system. Microtubule-associated serine/threonine-protein kinase 2 (MAST205) is a testis-specific, cytoplasmic protein that functions in a multi-protein complex in the maturation of spermatids. MAST205 is involved in linking the dystrophin/utrophin network with microtubule filaments via Syntrophin. By forming a complex with TRAF6, MAST205 regulates lipopolysaccharide-induced IL-12 synthesis in macrophages. This leads to the inhibition of TRAF6 NF-kappa-B activation. Two isoforms exist for MAST205 due to alternative splicing. Isoform 1 represents the full length protein, while isoform 2 lacks the residues 327-396 and 1091-1113. The N-terminus of MAST205 must be phosphorylated in order for ubiquitination to occur at the same site. This ubiquitination leads to the degradation of MAST205 via proteasome-mediated proteolysis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q6P0Q8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23139
Name Human MAST2 (aa 1539-1606) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias KIAA0807; Mast2; MAST205; microtubule associated serine/threonine kinase 2; microtubule associated testis specific serine/threonine protein kinase; microtubule-associated serine/threonine-protein kinase 2; Mtssk
Common Name MAST2
Gene Symbol MAST2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GESGEEDPFPSRDPRSLGPMVPSLLTGITLGPPRMESPSGPHRRLGSPQAIEEAASSSSAGPNLGQSG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.