missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human MAGEC1 Partial ORF (NP_005453.2, 1 a.a. - 139 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00009947-Q01.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16055185

  • 359.00 € / 10µg

Estimated Shipment: 22-11-2022
to see stock.
Add to basket

Description

Description

This gene is a member of the melanoma antigen gene (MAGE) family. The proteins of this family are tumor-specific antigens that can be recognized by autologous cytolytic T lymphocytes. This protein contains a large number of unique short repetitive sequences in front of the MAGE-homologous sequence, and therefore is about 800 aa longer than the other MAGE proteins. [provided by RefSeq]

Sequence: MGDKDMPTAGMPSLLQSSSESPQSCPEGEDSQSPLQIPQSSPESDDTLYPLQSPQSRSEGEDSSDPLQRPPEGKDSQSPLQIPQSSPEGDDTQSPLQNSQSSPEGKDSLSPLEISQSPPEGEDVQSPLQNPASSFFSSA
Specifications

Specifications

NP_005453.2
Liquid
9947
MAGEC1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CT7/MAGE-C1/MGC39366
MAGEC1
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
40.92kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MGDKDMPTAGMPSLLQSSSESPQSCPEGEDSQSPLQIPQSSPESDDTLYPLQSPQSRSEGEDSSDPLQRPPEGKDSQSPLQIPQSSPEGDDTQSPLQNSQSSPEGKDSLSPLEISQSPPEGEDVQSPLQNPASSFFSSA
RUO
MAGEC1
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Promotions

Promotions