missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human LZIP (aa 182-225) Control Fragment Recombinant Protein

Product Code. 30200549
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200549

Brand: Invitrogen™ RP104623

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65086 (PA5-65086. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds to the cAMP-responsive element, an octameric palindrome. The protein interacts with host cell factor C1, which also associates with the herpes simplex virus (HSV) protein VP16 that induces transcription of HSV immediate-early genes. This protein and VP16 both bind to the same site on host cell factor C1. It is thought that the interaction between this protein and host cell factor C1 plays a role in the establishment of latency during HSV infection. An additional transcript variant has been identified, but its biological validity has not been determined.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O43889
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10488
Name Human LZIP (aa 182-225) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AU044960; AW538053; basic leucine zipper protein; C80076; cAMP responsive element binding protein 3; cAMP-responsive element-binding protein 3; CREB3; CREB-3; cyclic AMP response element (CRE)-binding protein/activating transcription factor 1; cyclic AMP-responsive element-binding protein 3; leucin zipper proitein; Leucine zipper protein; Luman; LZIP; LZIP-1; LZIP-2; N-terminal Luman; Processed cyclic AMP-responsive element-binding protein 3; sLZIP; small leucine zipper protein; transcription factor LZIP; transcription factor LZIP-alpha
Common Name LZIP
Gene Symbol CREB3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.