missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human LYPLA1 Partial ORF (AAH08652.1, 66 a.a. - 151 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00010434-Q03.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16045245

  • 359.00 € / 10µg

Estimated Shipment: 22-11-2022
to see stock.
Add to basket

Description

Description

Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene hydrolyzes lysophosphatidylcholine in both monomeric and micellar forms. The use of alternate polyadenylation sites has been found for this gene. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet. [provided by RefSeq]

Sequence: NVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRAS
Specifications

Specifications

AAH08652.1
Liquid
10434
LYPLA1 (Human) Recombinant Protein (Q03)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
APT-1/LPL1/LYSOPLA
LYPLA1
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.2kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
NVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRAS
RUO
LYPLA1
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Promotions

Promotions