missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30181477

Invitrogen™ Human LXR alpha (aa 1-85) Control Fragment Recombinant Protein

Product Code. 30181477
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30181477 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30181477 Supplier Invitrogen™ Supplier No. RP97907

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NR1H3 (oxysterols receptor LXR-alpha) is a nuclear receptor that exhibits a ligand-dependent transcriptional activation activity. Its interaction with retinoic acid receptor (RXR) shifts RXR from its role as a silent DNA-binding partner to an active ligand-binding subunit in mediating retinoid responses through target genes defined by LXRES. LXRES are DR4-type response elements characterized by direct repeats of two similar hexanucleotide half-sites spaced by four nucleotides. NR1H3 plays an important role in the regulation of cholesterol homeostasis, regulating cholesterol uptake through MYLIP-dependent ubiquitination of LDLR, VLDLR, and LRP8. It also interplays functionally with RORA for the regulation of genes involves in liver metabolism.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q13133
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10062
Name Human LXR alpha (aa 1-85) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AU018371; liver x nuclear receptor alpha variant 1; liver x receptor alpha; LXR; LXR alpha; Lxra; LXR-a; LXRalpha; LXRb; NER; NERI; NR1H2; Nr1h3; nuclear orphan receptor LXR-alpha; nuclear oxysterol receptor LxR-alpha; nuclear receptor subfamily 1 group H member 3; nuclear receptor subfamily 1, group H, member 3; oxysterols receptor LXR-alpha; RLD1; RLD-1; ubiquitously-expressed nuclear receptor 1; Unr1
Common Name LXR alpha
Gene Symbol NR1H3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSAGGTAGVGLEAAEPTALLTRAEPPSEPTEIRPQKRK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.