missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30206518

Invitrogen™ Human LRP12 (aa 564-696) Control Fragment Recombinant Protein

Product Code. 30206518
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30206518 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30206518 Supplier Invitrogen™ Supplier No. RP90323

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53568 (PA5-53568. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Members of the LDL receptor gene family, including LDLR (low density lipoprotein receptor), LRP1 (low density lipoprotein related protein), Megalin (also designated GP330), VLDLR (very low density lipoprotein receptor) and ApoER2 are characterized by a cluster of cysteine-rich class A repeats, epidermal growth factor (EGF)-like repeats, YWTD repeats and an O-linked sugar domain. LRP12, also designated ST7, is a member of the LDLR family that is thought to be involved in the internalization of lipophilic molecules and/or signal transduction. LRP12 has been shown to interact with RACK1, MADHIP and Integrin beta-1-binding protein 3. It is widely expressed in heart, skeletal muscle, brain, lung, placenta and pancreas. Overexpression of LRP12 may be associated with oral tumors, therefore implicating LRP12 as a potential oncogene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9Y561
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 29967
Name Human LRP12 (aa 564-696) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI848829; C820005L12Rik; LDL receptor related protein 12; LDLR-related protein 12; low density lipoprotein receptor-related protein 12; low density lipoprotein-related protein 12; low-density lipoprotein receptor-related protein 12; LRP12; LRP-12; ST7; Suppressor of tumorigenicity 7 protein
Common Name LRP12
Gene Symbol LRP12
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FPVCSPNQASVLENLRLAVRSQLGFTSVRLPMAGRSSNIWNRIFNFARSRHSGSLALVSADGDEVVPSQSTSREPERNHTHRSLFSVESDDTDTENERRDMAGASGGVAAPLPQKVPPTTAVEATVGACASSS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.