missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30213183

Invitrogen™ Human LIAR (aa 13-78) Control Fragment Recombinant Protein

Product Code. 30213183
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30213183

Brand: Invitrogen™ RP104200

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64457 (PA5-64457. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Ankyrin (ANK) repeats mediate protein-protein interactions in diverse families of proteins. The number of ANK repeats in a protein can range from 2 to over 20. ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two anti-parallel helices and a beta-hairpin, with repeats stacked in a superhelical arrangement. LIAR, also known as ANKRD54, is a recently identified ANK repeat-containing protein that is predominantly expressed in tissues rich in ciliated cells, such as olfactory sensory neurons and is predicted to be important to cilia. At least three isoforms of LIAR are known to exist.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q6NXT1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 129138
Name Human LIAR (aa 13-78) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ANKRD54; ankyrin repeat domain 54; ankyrin repeat domain-containing protein 54; C730048E16Rik; EST1068184; EST475269; LIAR; Lyn-interacting ankyrin repeat protein; RGD1309552
Common Name LIAR
Gene Symbol ANKRD54
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RSGHSSSEGECAVAPEPLTDAEGLFSFADFGSALGGGGAGLSGRASGGAQSPLRYLHVLWQQDAEP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.