missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human LBX1 Partial ORF (NP_006553.2, 133 a.a. - 219 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00010660-Q01.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16075265

  • 341.70 € / 10µg

Estimated Shipment: 18-01-2022
Add to basket

Description

Description

This gene and the orthologous mouse gene were found by their homology to the Drosophila lady bird early and late homeobox genes. In the mouse, this gene is a key regulator of muscle precursor cell migration and is required for the acquisition of dorsal identities of forelimb muscles. [provided by RefSeq]

Sequence: TNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEMKADVESAKKLGPSGQMDIVALAELEQNSEATA
Specifications

Specifications

NP_006553.2
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.20kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
TNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEMKADVESAKKLGPSGQMDIVALAELEQNSEATA
RUO
LBX1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
10660
LBX1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
HPX-6/HPX6/LBX1H/homeobox
LBX1
Yes
Videos
SDS
Documents
Certificates
Promotions

Promotions