missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30202082

Invitrogen™ Human KIAA1456 (aa 191-261) Control Fragment Recombinant Protein

Product Code. 30202082
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30202082 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30202082 Supplier Invitrogen™ Supplier No. RP93899

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55150 (PA5-55150. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

C8orf79 (chromosome 8 open reading frame 79) is a 454 amino acid protein that belongs to the methyltransferase superfamily and is encoded by a gene that maps to human chromosome 8p22. Consisting of nearly 146 million bases, chromosome 8 encodes about 800 genes. Translocation of portions of chromosome 8 with amplifications of the c-Myc gene are found in some leukemias and lymphomas, and are typically associated with a poor prognosis. Portions of chromosome 8 have been linked to schizophrenia and bipolar disorder.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9P272
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 57604
Name Human KIAA1456 (aa 191-261) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 6430573F11Rik; C27H8ORF79; C8orf79; KIAA1456; Probable tRNA methyltransferase 9 B; probable tRNA methyltransferase 9-like protein; RIKEN cDNA 6430573F11 gene; RM9L; TRM9L; Trmt9b; Trmt9l; tRNA methyltransferase 9 B (putative)
Common Name KIAA1456
Gene Symbol TRMT9B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HPPCSECSCSVCFKEQCGSKRSHSVGYEPAMARTCFANISKEGEEEYGFYSTLGKSFRSWFFSRSLDESTL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.