missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30198072

Invitrogen™ Human IL31RA (aa 592-672) Control Fragment Recombinant Protein

Product Code. 30198072
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30198072

Brand: Invitrogen™ RP108537

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (52%), Rat (52%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111631 (PA5-111631. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

IL-31 is a T cell cytokine that is preferentially produced by T helper type 2 cells. IL-31 signals through a heterodimeric receptor composed of the IL-31 receptor (IL-31R) and the oncostatin M receptor (OSM). This receptor complex recruits JAK1, JAK2, Stat1, Stat3 and Stat5 signaling pathways, as well as the PI3 kinase/AKT cascade. SHP-2 and Shc adapter molecules are also recruited and contribute to an increased activation of the MAP kinase pathway in response to IL-31. Overexpression of IL-31 in mice results in pruritus and skin dermatitis resembling human atopic dermatitis (AD). Comparisons between skin from patients with AD and healthy skin showed IL-31R expression at higher levels on epidermal keratinocytes in AD samples. Infiltrating cells, more numerous in skin from patients with AD compared with that of healthy individuals, expressed IL-31 mRNA. IL-31 may participate in the cause of itch sensation and promote scratching behavior in NC/Nga mice with atopic dermatitis, and may represent a novel target for antipruritic drug development.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8NI17
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 133396
Name Human IL31RA (aa 592-672) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias class I cytokine receptor; CRL; CRL 3; CRL3; CRL3Glmr; cytokine receptor NR10; cytokine receptor-like 3; GLM R; Glmr; GLM-R; GLM-RMGC125346; GP130 like receptor; gp130-like monocyte receptor; Gp130-like receptor; GPL; HGLM R; HGLMR; hGLM-R; IL 31 RA; IL-31 receptor subunit alpha; IL31R subunit alpha; IL-31 R subunit alpha; Il31ra; IL-31 RA; IL-31 RAGPLCRL; IL-31 R-alpha; interleukin 31 receptor A; interleukin 31 RA; interleukin-31 receptor subunit alpha; MGC125346; mGLM-R; novel cytokine receptor 10; NR10; PLCA 2; PLCA2; PRO21384; soluble type I cytokine receptor CRL3; UNQ6368/PRO21073/PRO21384; ZcytoR17
Common Name IL31RA
Gene Symbol IL31RA
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ILKPCSTPSDKLVIDKLVVNFGNVLQEIFTDEARTGQENNLGGEKNGYVTCPFRPDCPLGKSFEELPVSPEIPPRKSQYLR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.