missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30203064

Invitrogen™ Human IGFBP5 (aa 155-210) Control Fragment Recombinant Protein

Product Code. 30203064
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30203064 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30203064 Supplier Invitrogen™ Supplier No. RP105988

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111496 (PA5-111496. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The insulin-like growth factor-binding proteins, or IGFBPs, are a family of homologous proteins that have co-evolved with the IGFs. They serve not only as shuttle molecules for the soluble IGFs, but also confer a level of regulation to the IGF signaling system. Physical association of the IGFBPs with IGF influences the bio-availability of the growth factors, as well as their concentration and distribution in the extracellular environment. In addition, the IGFBPs appear to have biological activity independent of the IGFs. Seven IGFBPs have thus far been described, each differing in their tissue distribution, half-lives and modulation of IGF interactions with their receptors. For instance, IGFBP1 is negatively regulated by insulin production. The IGFBP1 gene is expressed at a high level during fetal liver development and in response to nutritional changes and diabetes. It has been suggested that IGFBP2 functions as chaperone, escorting IGFs to their target tissues. It is expressed in several human tissues including fetal eye and fetal brain. IGFBP3 is the most abundant IGFBP and is complexed with roughly 80% of the serum IGFs. Both IGFBP3 and IGFBP4 are released by dermal fibroblasts in response to incision injury. IGFBP5 is secreted by myoblasts and may play a key role in muscle differentiation.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P24593
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3488
Name Human IGFBP5 (aa 155-210) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI256729; AW208790; IBP 5; IBP5; IBP-5; IGF BP5; IGF-binding protein 5; IGFBP; IGFBP 5; Igfbp5; IGF-BP5; Igfbp-5; IGFBP-5 P; Insulin like growth factor binding protein; insulin like growth factor binding protein 5; insulin-like growth factor binding protein 5; insulin-like growth factor binding protein-5; insulin-like growth factor-binding protein 5
Common Name IGFBP5
Gene Symbol IGFBP5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DRRKKLTQSKFVGGAENTAHPRIISAPEMRQESEQGPCRRHMEASLQELKASPRMV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.