missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human H1F0 Partial ORF (NP_005309.1, 42 a.a. - 95 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00003005-Q01.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16084105

  • 518.16 € / 25µg

Estimated Shipment: 30-12-2021
Add to basket

Description

Description

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a member of the histone H1 family. [provided by RefSeq]

Sequence: RAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRL
Specifications

Specifications

NP_005309.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
31.68kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
RAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRL
RUO
H1F0
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
3005
H1F0 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
H10/H1FV/MGC5241
H1F0
Yes
Videos
SDS
Documents
Certificates
Promotions

Promotions