missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30200332

Invitrogen™ Human GPR19 (aa 6-55) Control Fragment Recombinant Protein

Product Code. 30200332
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30200332 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30200332 Supplier Invitrogen™ Supplier No. RP90888

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (60%), Rat (60%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The G-protein-coupled receptor (GPCR) superfamily is comprised of an estimated 600-1, 000 members and is the largest known class of molecular targets with proven therapeutic value. GPR19 is an orphan receptor found primarily in the central nervous system. GPR19 was also found in ovary and testis and in human embryonic stem cells. GPR19 has been postulated to play a role in cancer development and increased levels of GPR19 mRNA were found in metastatic melanoma, small cell lung carcinoma and pancreas islet cell carcinoma.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q15760
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2842
Name Human GPR19 (aa 6-55) Control Fragment
Quantity 100 μL
Gene Alias G protein-coupled receptor 19; GPR19; GPR-NGA; Probable G-protein coupled receptor 19
Common Name GPR19
Gene Symbol GPR19
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RMDNSKPHLIIPTLLVPLQNRSCTETATPLPSQYLMELSEEHSWMSNQTD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.