missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30203687

Invitrogen™ Human GPR125 (aa 147-283) Control Fragment Recombinant Protein

Product Code. 30203687
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30203687 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30203687 Supplier Invitrogen™ Supplier No. RP89573

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52626 (PA5-52626. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

G protein-coupled receptors (GPRs), also known as seven transmembrane receptors, heptahelical receptors or 7TM receptors, comprise a superfamily of proteins that play a role in many different stimulus-response pathways. G protein coupled receptors translate extracellular signals into intracellular signals (G protein activation) and they respond to a variety of signaling molecules, such as hormones and neurotransmitters. GPR125 (G protein-coupled receptor 125), also known as PGR21 or TEM5L, is a 1,321 amino acid multi-pass membrane protein belonging to the G-protein coupled receptor 2 family and the LN-TM7 subfamily. Considered a novel orphan adhesion-type G-protein-coupled receptor, GPR125 has five leucine rich repeats (LRR), an immunoglobulin (Ig) domain and a GPS domain. GPR125 may play a functional role in choroidal and hippocampal response to brain injury. It is also suggested that GPR125 may be a marker for spermatogonial stem cells. Four isoforms of GPR125 exists due to alternative splicing events.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8IWK6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 166647
Name Human GPR125 (aa 147-283) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 3830613O22Rik; Adgra2; ADGRA3; adhesion G protein-coupled receptor A2; adhesion G protein-coupled receptor A3; AU044632; G protein-coupled receptor 125; Gpr125; G-protein coupled receptor 125; PGR21; probable G-protein coupled receptor 125; TEM5L; Tem5-like; UNQ556/PRO1113
Common Name GPR125
Gene Symbol ADGRA3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DIFRGLTNLVRLNLSGNLFSSLSQGTFDYLASLRSLEFQTEYLLCDCNILWMHRWVKEKNITVRDTRCVYPKSLQAQPVTGVKQELLTCDPPLELPSFYMTPSHRQVVFEGDSLPFQCMASYIDQDMQVLWYQDGRI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.