missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human FUZ (aa 140-224) Control Fragment Recombinant Protein

Product Code. 30182185
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30182185

Brand: Invitrogen™ RP98851

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59909 (PA5-59909. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FUZ is the human homolog of Drosophila fy protein and belongs to the fuzzy family. The fy gene of Drosophila encodes a novel four-pass transmembrane protein that plays two roles in the development of hairs on the Drosophila wing. The first is to specify the correct orientation of the hair by restricting its initiation to the distal vertex of the cell. The second role is to permit the development of just a single cell hair by maintaining the integrity of the F-actin and microtubule arrays that are required for hair development. In humans, the protein is involved in cytoskeleton function and cell polarity in epithelial cells. The human fuz gene is localized on chromosome 19q13.33.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9BT04
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 80199
Name Human FUZ (aa 140-224) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2600013E07Rik; b2b1273Clo; Fuz; fuzzy homolog; fuzzy homolog (Drosophila); fuzzy planar cell polarity protein; FY; NTD; Protein fuzzy homolog; RGD1310608
Common Name FUZ
Gene Symbol FUZ
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GDSELIGDLTQCVDCVIPPEGSLLQEALSGFAEAAGTTFVSLVVSGRVVAATEGWWRLGTPEAVLLPWLVGSLPPQTARDYPVYL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.