missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30197869

Invitrogen™ Human FRMPD1 (aa 824-927) Control Fragment Recombinant Protein

Product Code. 30197869
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30197869 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30197869 Supplier Invitrogen™ Supplier No. RP92882

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60166 (PA5-60166. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The FERM and PDZ domain containing (FRMPD) protein family consists of four proteins that contain a FERM (Four-point-one, erzin, radixin, moesin) domain and at least one PDZ (PSD-95/Discs large/Zonula-occuldens-1) domain. FRMPD1 was initially identified through a yeast two-hybrid screening with Activator of G-protein signaling 3 (AGS3), a protein that acts to stabilize the GDP-bound conformation of Gai, as the bait. FRMPD1 binds to the tetratricopeptide repeat of AGS3 and stabilizes AGS3 in a membrane environment. Suppression of FRMPD1 in Cath.a-differentiated neuronal cells decreased the level of endogenous AGS3 in membrane fractions by ∽50% and enhanced the inhibition of forskolin-induced increases in cAMP. Co-immunoprecipitation studies indicate that the interaction of AGS3 with FRMPD1 is mutually exclusive with the interaction of AGS3 with Gai3, suggesting that FRMPD1 may position AGS3 in the membrane where it can then interact with Galphai.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q5SYB0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 22844
Name Human FRMPD1 (aa 824-927) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias BC031840; FERM and PDZ domain containing 1; FERM and PDZ domain-containing protein 1; FERM domain-containing protein 2; FRMD2; Frmpd1; Kiaa0967; mKIAA0967; RP11-263I4.1
Common Name FRMPD1
Gene Symbol FRMPD1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RRGGVKKYAKTLRKRRSFLQTDYTSQVSFPLVPSASLESVDDVCYYDREPYLALGAPSPTVSSLQDMQGEPGLLETKALGLLAPLRETKSTNPASRVMEMEPET
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.