missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human FOXF1 Partial ORF (NP_001442.1, 251 a.a. - 353 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00002294-Q03.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16083995

  • 341.70 € / 10µg

Estimated Shipment: 18-01-2022
Add to basket

Description

Description

This gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the regulation of pulmonary genes as well as embryonic development. [provided by RefSeq]

Sequence: AALNSGASYIKQQPLSPCNPAANPLSGSLSTHSLEQPYLHQNSHNAPAELQGIPRYHSQSPSMCDRKEFVFSFNAMASSSMHSAGGGSYYHQQVTYQDIKPCV
Specifications

Specifications

NP_001442.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.96kDa
12.5% SDS-PAGE Stained with Coomassie Blue
AALNSGASYIKQQPLSPCNPAANPLSGSLSTHSLEQPYLHQNSHNAPAELQGIPRYHSQSPSMCDRKEFVFSFNAMASSSMHSAGGGSYYHQQVTYQDIKPCV
RUO
FOXF1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
2294
FOXF1 (Human) Recombinant Protein (Q03)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FKHL5/FREAC1/MGC105125
FOXF1
Yes
Videos
SDS
Documents
Certificates
Promotions

Promotions