missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human FCRL3 Partial ORF (NP_001019838, 625 a.a. - 723 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00115352-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16101487

  • 341.70 € / 10µg

Estimated Shipment: 24-01-2022
Add to basket

Description

Description

This gene encodes a member of the immunoglobulin receptor superfamily and is one of several Fc receptor-like glycoproteins clustered on the long arm of chromosome 1. The encoded protein contains immunoreceptor-tyrosine activation motifs and immunoreceptor-tyrosine inhibitory motifs in its cytoplasmic domain and may play a role in regulation of the immune system. Mutations in this gene have been associated with rheumatoid arthritis, autoimmune thyroid disease, and systemic lupus erythematosus. [provided by RefSeq]

Sequence: SRPSRIDPQEPTHSKPLAPMELEPMYSNVNPGDSNPIYSQIWSIQHTKENSANCPMMHQEHEELTVLYSELKKTHPDDSAGEASSRGRAHEEDDEENYE
Specifications

Specifications

NP_001019838
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
SRPSRIDPQEPTHSKPLAPMELEPMYSNVNPGDSNPIYSQIWSIQHTKENSANCPMMHQEHEELTVLYSELKKTHPDDSAGEASSRGRAHEEDDEENYE
RUO
FCRL3
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
115352
FCRL3 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FCRH3/IFGP3/IRTA3/SPAP2
FCRL3
Yes
Videos
SDS
Documents
Certificates
Promotions

Promotions