missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30204186

Invitrogen™ Human ERp72 (aa 401-545) Control Fragment Recombinant Protein

Product Code. 30204186
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30204186

Brand: Invitrogen™ RP88776

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ERp72 is an endoplasmic reticulum luminal protein that is both a stress protein and a member of the protein disulfide isomerase family of proteins. Sequence analysis of ERp72 shows that it shares sequence identity with PDI (protein disulphide isomerase) at three discrete regions, as well as containing the ER retention signal KEEL at its C-terminus. ERp72 is shown to have three copies of sequence believed to be CGHC-containing active sites, which are also found in PDI. These CGHC sites are critical sites that are involved in the protein disulphide isomerization process. These results suggest that ERp72 is a newly described member of the family of CGHC-containing proteins that functions as a molecular chaperone.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P13667
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9601
Name Human ERp72 (aa 401-545) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI987846; caBP2; Cai; calcium binding protein, intestinal; calcium-binding protein 2; EC 5.3.4.1; endoplasmic reticulum protein 72; endoplasmic reticulum resident protein 70; Endoplasmic reticulum resident protein 72; ER protein 70; ER protein 72; Erp70; Erp72; ERp-72; PDIA4; protein disu; protein disulfide isomerase A4; protein disulfide isomerase associated 4; protein disulfide isomerase family A member 4; protein disulfide isomerase family A, member 4; protein disulfide isomerase related protein (calcium-binding protein, intestinal-related); protein disulfide isomerase-associated 4; protein disulfide-isomerase A4; Protein ERp-72; testicular tissue protein Li 137
Common Name ERp72
Gene Symbol PDIA4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KVSNDAKRYTRRPLVVVYYSVDFSFDYRAATQFWRSKVLEVAKDFPEYTFAIADEEDYAGEVKDLGLSESGEDVNAAILDESGKKFAMEPEEFDSDTLREFVTAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDSIVMDPKKD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.