missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30194590

Invitrogen™ Human ERK1 (aa 27-157) Control Fragment Recombinant Protein

Product Code. 30194590
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30194590

Brand: Invitrogen™ RP102150

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MAPK3 (ERK1) is a serine/threonine kinase that is an important activator of p90, RSK, MSK, ELK1, and Stat3, and is involved in the MAPK pathway. ERK1 is widely expressed and involved in the regulation of meiosis, mitosis, and post-mitotic functions in differentiated cells. Many different stimuli, including growth factors, cytokines, virus infection, ligands for heterotrimeric guanine nucleotide-binding protein (G protein)-coupled receptors and transforming agents, activate the ERK1 and ERK2 pathways. Functionally, ERK1 is involved with a signaling cascade that regulates various cellular processes such as proliferation, differentiation, and cell cycle progression in response to a variety of extracellular signals. ERK1 is activated by upstream kinases, resulting in its translocation to the nucleus where it phosphorylates nuclear targets. Alternatively spliced transcript variants encoding different protein isoforms of ERK1 have been described.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P27361
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5595
Name Human ERK1 (aa 27-157) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ERK; Erk1; ERK-1; Ert2; Esrk1; Extracellular signal-regulated kinase 1; extracellular signal-related kinase 1; HS44KDAP; HUMKER1A; Insulin-stimulated MAP2 kinase; MAP kinase 1; MAP kinase 3; MAP kinase isoform p44; MAP kinase2; MAPK 1; MAPK 3; MAPK1; MAPK2; MAPK3; Microtubule-associated protein 2 kinase; mitogen activated protein kinase 3; mitogen-activated 3; mitogen-activated protein kinase 1; mitogen-activated protein kinase 3; MNK1; Mtap2k; p44; p44 MAP kinase; P44ERK1; p44-ERK1; P44MAPK; p44-MAPK; pp42/MAP kinase; PRKM3
Common Name ERK1
Gene Symbol MAPK3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.