missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human EPHB1 Partial ORF (NP_004432.1, 221 a.a. - 320 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

335.00 € - 508.00 €

Specifications

Accession Number NP_004432.1
For Use With (Application) Antibody Production, ELISA, Protein Array, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 2047
Molecular Weight (g/mol) 36.63kDa
View More Specs

Products 2
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
16137714
View Documents Promotion Details
Abnova™
H00002047-Q01.10UG
10 ug
335.00 €
10µg
View alternative products
Save Up to 
»
Estimated Shipment: 25-06-2024
to see stock.
Please to purchase this item. Need a web account? Register with us today!
16147714
View Documents Promotion Details
Abnova™
H00002047-Q01.25UG
25 ug
508.00 €
25µg
View alternative products
Save Up to 
»
Estimated Shipment: 25-06-2024
to see stock.
Please to purchase this item. Need a web account? Register with us today!
Description

Description

Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The protein encoded by this gene is a receptor for ephrin-B family members. [provided by RefSeq]

Sequence: ARGTCIPNAEEVDVPIKLYCNGDGEWMVPIGRCTCKPGYEPENSVACKACPAGTFKASQEAEGCSHCPSNSRSPAEASPICTCRTGYYRADFDPPEVACT
Specifications

Specifications

NP_004432.1
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ELK/EPHT2/FLJ37986/Hek6/NET
EPHB1
Recombinant
wheat germ expression system
Antibody Production, ELISA, Protein Array, Western Blot
2047
EPHB1 (Human) Recombinant Protein (Q01)
ARGTCIPNAEEVDVPIKLYCNGDGEWMVPIGRCTCKPGYEPENSVACKACPAGTFKASQEAEGCSHCPSNSRSPAEASPICTCRTGYYRADFDPPEVACT
RUO
EPHB1
Wheat Germ (in vitro)
GST
Liquid
Videos
SDS
Documents

Documents

Product Certifications