missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human DUSP12 (aa 165-313) Control Fragment Recombinant Protein

Product Code. 30196645
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30196645 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30196645 Supplier Invitrogen™ Supplier No. RP89148

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110753 (PA5-110753. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Dual specificity phosphatase (DUSP) inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. DUSPs can be divided into six subgroups on the basis of sequence similarity (PRLs, Cdc14 phosphatases, PTENs, myotubularins, MKPs, atypical DUSPs). DUSP inhibitors might be used to manipulate MAPK and cellular responses in both positive and negative ways. The regulated expression and activity of DUSP family members in different cells and tissues controls MAPK intensity and duration to determine the type of physiological response. DUSP12 (YVH1, GKAP) contains the consensus DUSP catalytic domain as well as an extended C-terminal domain of unknown function, thought to be related to its potential role in glucokinase regulation. It is localized in the cytoplasm and nucleus.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9UNI6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 11266
Name Human DUSP12 (aa 165-313) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1190004O14Rik; AA027408; AW049275; dual specificity phosphatase 12; dual specificity phosphatase T-DSP4; Dual specificity phosphatase VH1; dual specificity protein phosphatase 12; Dual specificity tyrosine phosphatase YVH1; DUSP1; Dusp12; ESTM36; LMW-DSP4; mVH1; serine/threonine specific protein phosphatase; T-DSP4; VH1; YVH1; YVH1 protein-tyrosine phosphatase ortholog
Common Name DUSP12
Gene Symbol Dusp12
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YQAMGYEVDTSSAIYKQYRLQKVTEKYPELQNLPQELFAVDPTTVSQGLKDEVLYKCRKCRRSLFRSSSILDHREGSGPIAFAHKRMTPSSMLTTGRQAQCTSYFIEPVQWMESALLGVMDGQLLCPKCSAKLGSFNWYGEQCSCGRWI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.