missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human DNAL1 (aa 103-186) Control Fragment Recombinant Protein

Product Code. 30209222
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30209222

Brand: Invitrogen™ RP108989

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DNAL1 was identified as a potential candidate gene for primary ciliary dyskinesia (PCD), a genetically heterologous disorder characterized by chronic infections of the upper and lower airways that often leads to permanent lung damage, randomization of left/right body symmetry, and reduced fertility. DNAL1 is reported to be expressed solely in tissues carrying motile cilia for flagella and interacts with DNAH5, a protein that when mutated has been shown to result in PCD. It has been suggested that DNAL1 serves a regulatory function for DNAH5 activity in outer dynein arms of sperm flagella, respiratory cilia, and ependymal cilia. DNAL1 has also been recently identified as an HIV dependency factor (HDF), suggesting that DNAL1 may be an important drug target in HIV treatment. At least two isoforms of DNAL1 are known to exist.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q4LDG9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 83544
Name Human DNAL1 (aa 103-186) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1700010H15Rik; AW121714; axonemal dynein light chain 1; C14orf168; CILD16; DNAL1; Dnalc1; dynein axonemal light chain 1; dynein light chain 1, axonemal; dynein, axonemal, light chain 1; E330027P08Rik; LC1
Common Name DNAL1
Gene Symbol Dnal1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NFIEKLKGIHIMKKLKILYMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAENNWIEEATKRVPKLKKLDGTPVIKGDE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.