missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human DICER1 Partial ORF (NP_803187, 1813 a.a. - 1912 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

335.00 € - 508.00 €

Specifications

Accession Number NP_803187
For Use With (Application) Antibody Production, ELISA, Protein Array, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 23405
Molecular Weight (g/mol) 36.74kDa
View More Specs

Productos 2
Código de producto Marca Quantity Precio Cantidad y disponibilidad  
Código de producto Marca Quantity Precio Cantidad y disponibilidad  
16147272
missing translation for 'viewDocuments' Detalles de la promoción
Abnova™
H00023405-Q01.25UG
25 ug
508.00 €
25µg
Ver productos alternativos
missing translation for 'toSaveUpto' 
»
Estimated Shipment: 25-06-2024
to see stock.
Please to purchase this item. Need a web account? Register with us today!
16137272
missing translation for 'viewDocuments' Detalles de la promoción
Abnova™
H00023405-Q01.10UG
10 ug
335.00 €
10µg
Ver productos alternativos
missing translation for 'toSaveUpto' 
»
Estimated Shipment: 25-06-2024
to see stock.
Please to purchase this item. Need a web account? Register with us today!
Descripción

Descripción

This gene encodes a protein possessing an RNA helicase motif containing a DEXH box in its amino terminus and an RNA motif in the carboxy terminus. The encoded protein functions as a ribonuclease and is required by the RNA interference and small temporal RNA (stRNA) pathways to produce the active small RNA component that represses gene expression. Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq]

Sequence: ESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLEMEPETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRSL
Especificaciones

Especificaciones

NP_803187
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DCR1/Dicer/HERNA/KIAA0928
DICER1
Recombinant
wheat germ expression system
Antibody Production, ELISA, Protein Array, Western Blot
23405
DICER1 (Human) Recombinant Protein (Q01)
ESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLEMEPETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRSL
RUO
DICER1
Wheat Germ (in vitro)
GST
Liquid
Videos
SDS
Documentos

Documentos

Certificados