missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human D8S2298E Partial ORF (NP_005662, 173 a.a. - 268 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00007993-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16138115

  • 508.00 € / 25µg
Estimated Shipment: 28-05-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: TCKEIPDLPEEPSQTAEEVVTVALRCPSGNVLRRRFLKSYSSQVLFDWMTRIGYHISLYSLSTSFPRRPLAVEGGQSLEDIGITVDTVLILEEKEQ
Specifications

Specifications

NP_005662
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.3kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
TCKEIPDLPEEPSQTAEEVVTVALRCPSGNVLRRRFLKSYSSQVLFDWMTRIGYHISLYSLSTSFPRRPLAVEGGQSLEDIGITVDTVLILEEKEQ
RUO
UBXN8
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
7993
D8S2298E (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
D8S2298E/REP8/UBXD6
UBXN8
Recombinant
wheat germ expression system
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Promotions

Promotions