missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CYP7A1 Partial ORF (NP_000771.2, 179 a.a. - 277 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00001581-Q01.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16043885

  • 545.00 € / 25µg

Estimated Shipment: 31-10-2022
to see stock.
Add to basket

Description

Description

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum membrane protein catalyzes the first reaction in the cholesterol catabolic pathway in the liver, which converts cholesterol to bile acids. This reaction is the rate limiting step and the major site of regulation of bile acid synthesis, which is the primary mechanism for the removal of cholesterol from the body. [provided by RefSeq]

Sequence: MFEAGYLTIFGRDLTRRDTQKAHILNNLDNFKQFDKVFPALVAGLPIHMFRTAHNAREKLAESLRHENLQKRESISELISLRMFLNDTLSTFDDLEKAK
Specifications

Specifications

NP_000771.2
Liquid
1581
CYP7A1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CP7A/CYP7/MGC126826/MGC138389
CYP7A1
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue
MFEAGYLTIFGRDLTRRDTQKAHILNNLDNFKQFDKVFPALVAGLPIHMFRTAHNAREKLAESLRHENLQKRESISELISLRMFLNDTLSTFDDLEKAK
RUO
CYP7A1
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Promotions

Promotions