missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30198852

Invitrogen™ Human CYP24A1 (aa 142-208) Control Fragment Recombinant Protein

Product Code. 30198852
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30198852 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30198852 Supplier Invitrogen™ Supplier No. RP105285

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66632 (PA5-66632. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein initiates the degradation of 1,25-dihydroxyvitamin D3, the physiologically active form of vitamin D3, by hydroxylation of the side chain. In regulating the level of vitamin D3, this enzyme plays a role in calcium homeostasis and the vitamin D endocrine system. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q07973
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1591
Name Human CYP24A1 (aa 142-208) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1,25-@dihydroxyvitamin D3 24-hydroxylase; 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; 24-OHase; 24 R-Ohase; 25-hydroxyvitamin D-24-hydroxylase; 25-hydroxyvitamin D3 24-hydroxylase; 25-hydroxyvitaminD324-hydroxylase; CP24; CYP24; Cyp-24; CYP24A1; Cytochrom P450 (25-hydroxyvitamin D24-hydroxylase); cytochrome P450 24A1; cytochrome P450 family 24 subfamily A member 1; cytochrome P450, 24; cytochrome P450, 24a1; cytochrome P450, family 24, subfamily a, polypeptide 1; cytochrome P450, subfamily 24; cytochrome P450, subfamily XXIV (vitamin D 24-hydroxylase); cytochrome P450-CC24; exo-mitochondrial protein; HCAI; HCINF1; MGC126273; MGC126274; P450-CC24; vitamin D 24-hydroxylase; vitamin D(3) 24-hydroxylase; VITD12
Common Name CYP24A1
Gene Symbol Cyp24a1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KEGYGLLILEGEDWQRVRSAFQKKLMKPGEVMKLDNKINEVLADFMGRIDELCDERGHVEDLYSELN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.